SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10018954m|PACid:20887524 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10018954m|PACid:20887524
Domain Number 1 Region: 113-257
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.37e-41
Family B3 DNA binding domain 0.0044
Further Details:      
 
Domain Number 2 Region: 488-565
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000000598
Family PB1 domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10018954m|PACid:20887524
Sequence length 593
Sequence
MASVEGDGDFRTSLSSSYHDQLYTELWKACAGPLVEVPRPQERVFYFPQGHMEQLVASTN
QGIKSEEIPKFNLPPKILCRVLGVTLKAEHETDEVYAQITLQPEEHQIEPTSLDPPLVEP
AKQMFHSFVKILTASDTSTHGGFSVLRKHATECLPALDMTQATPTQELVARDLHGFEWRF
KHIFRGQPRRHLLTTGWSTFVSSKRLVAGDAFVFLRGENGDLRVGVRRLARHQSTMPTSV
ISSQSMHLGVLATASHAVGSKTLFVVFYKPRISQFIVGVNKYMEAIKHGFSLGTRFRMRF
EGEESPERIFTGTIVGTGDLSSQWPASKWRSLQVQWDEPTTFQRPDKVSPWEIEPFLPTS
PNSSPTQQPQSKCKRSRPIEPSVITPAPPSFLYSFPQSQDSINATIKVFQDPPLERNSGG
YSSNNNFKAETPPPPTNGCYRLFGFNLTSNPPAPILLDKQPNETSGAATCQESITPSSTN
EQRKQQTSRSRTKVQMQGIAVGRAVDLTLLKSYDELIKELEKMFEIQGQLRPRDKWVVVF
TDDEGDMMLAGDDPWNEFCKMAKKIFIYSRDEVKKMTTKLKHYSSLENEDGKE
Download sequence
Identical sequences R0FT39
Carubv10018954m|PACid:20887524 XP_006292708.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]