SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10019207m|PACid:20887526 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10019207m|PACid:20887526
Domain Number 1 Region: 401-679
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 1.44e-74
Family Creatinase/aminopeptidase 0.00000357
Further Details:      
 
Domain Number 2 Region: 182-289
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.22e-30
Family B3 DNA binding domain 0.0000036
Further Details:      
 
Domain Number 3 Region: 59-115
Classification Level Classification E-value
Superfamily DNA-binding domain 1.9e-16
Family GCC-box binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10019207m|PACid:20887526
Sequence length 681
Sequence
MSSVDESSTTTDSIHTPVKIPAKKSPSPAGLLYRMGSGTSVVLDSENGLEAESRKLPSSR
FKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEDEAARAYDVAAHRFRGRDAVTNFKEAKVD
DDEEVEFLNDHSKSEIVDMLRKHTYNEELEQRKRKRYGNGNKTTGFGSVTVAVITGFKTS
GLLFEKTVTPSDVGKLNRLVIPKHQAEKHFPLSGGDESNVSVKGMLLNFEDVNGKVWRFR
YSYWNSSQSYVLTKGWSRFVKEKRLCAGDSICFKRSNGQDHKLYIGWKSKSGSGSGSDQD
TGRIVRLFGVDICFSDTAGLVVKEEAEMSMSLKCNNHKKQRKIIPSRSLFNGSKLTPSKY
FAGAPTNFSSFPLSGKKKSYSLRIKRIQQLQNSLEDRINPPLVCGRVTPRLCVPDHILKP
SYVESSEVPRISSEIQIPDSIGIVKMKKACELAARVLDYAGTLVRPFVTTDEIDKAVHQM
VIESGAYPSPLGYGGFPKSVCTSVNECMFHGIPDSRPLQNGDIINIDVAVYLDGYHGDTS
KTFLCGDVDESLIQLVKVTEECLEKGISVCKDGANFKQIGKIISEHAAKYGYNMERFIGH
GVGTVLHSEPLIYLHSNYDYELEYMIEGQTFTLEPILTIGTTEFVTWPDKWTIVTADGGP
AAQFEHTILITTTGSEILTIS
Download sequence
Identical sequences R0H8Z4
XP_006292936.1.15642 Carubv10019207m|PACid:20887526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]