SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10019277m|PACid:20885718 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10019277m|PACid:20885718
Domain Number 1 Region: 11-105
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.24e-23
Family B3 DNA binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 183-277
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000235
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10019277m|PACid:20885718
Sequence length 281
Sequence
MAEHDDDVLLPRFFKVFLSESASESFAIPLSFMEHLADPLPNTAKLQGTGGRDWTVNMTK
IRDGVYFTAGWSKFAQDHELVDGEFLTFVYDGHRTFEVSVFGRLGCKETRAEVEAIAVDG
SSSDSDGSSSDSEEERELSMDFYGDTSLGEDEEISQSLYPLEDEETESDSAVVEGNLDIE
ALTNPHFSTTLKNRIYELLIPANVVKENKLTFGDSVKYIDGEGTLVGLRGKWADDRICFK
GWDRICRRNRLKKHQDTVECELLHDRNKVHSIRVHIMRGTT
Download sequence
Identical sequences R0HPM7
XP_006293000.1.15642 Carubv10019277m|PACid:20885718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]