SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10019454m|PACid:20885881 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10019454m|PACid:20885881
Domain Number 1 Region: 121-249
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.93e-29
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 431-509
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000054
Family PB1 domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Carubv10019454m|PACid:20885881
Sequence length 533
Sequence
MDSCNVANVQPDLSRTLDGSESYMYEQLWKWCAGPLCHLPNLGDKVYYFPQGHIELVEAS
TREELNQIQSNFNLHSKLECRVIAVRLKKRKKKTDQVYAEITLIPDATQVVIPTQNDSQY
RPKVNSFLKILTASDTSTHGGLSVPKRSATKCLPPLDMGISVPTQEIFTKDLHDSVWKFK
HSFRGTPQRHLLTTGWSAFVTTKSLVVGVAFILLRGETGELRVGIRRARHQQGNITSSLV
STENMRHGVIASALHAFNNQCMFTVVFKPRSSQFIVKYDKFLDAVNNKFNVESRFTMRFE
TEDFSEKVDNFSPHWKDSEWRSLQVRWDELASFPRPEKVSPWEIEHIPPSSNVPQSFLLK
EQAFTTQVVLPSMTNEGGTSFRLFGVSLVVPSRKNESYQVSNTSKLSQEKKFGLTQTFKL
PKMAKSKQFSSTKSCTKVQLQGVTVGRALDLSVLNGYDQLIHELEKLFDLKGELRSRNQW
EMVFIDHEGDIVLIGDVPWLEFCNMVKKILICSKEEIKKLKYERPISQTKPKA
Download sequence
Identical sequences R0HLE5
XP_006293142.1.15642 Carubv10019454m|PACid:20885881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]