SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10020115m|PACid:20906815 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10020115m|PACid:20906815
Domain Number 1 Region: 53-486
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.51e-131
Family Pyridoxal-dependent decarboxylase 0.00000000985
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10020115m|PACid:20906815
Sequence length 537
Sequence
MQICRVNLINTINVASSLHHLFVSFLVHLFLFHTLTRKQNTKMVLSRTQTNSDESVCTMF
GSRYVRTTLPKYEIGEASIPKDAAYQIIKDELMLDGNPRLNLASFVTTWMEPECDKLIMD
SINKNYVDMDEYPVTTELQNRCVNIIARLFNAPLEETETAVGVGTVGSSEAIMLAGLAFK
RKWQNRRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKEVKLSEGYYVMDPDKAAEM
VDENTICVAAILGSTLNGEFEDVKRLNDLLVKKNEETGWNTPIPVDAASGGFIAPFIYPE
LEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRAPEDLPEELIFHINYLGADQPTFTLNF
SKGSSQIIAQYYQLIRLGFEGYKNVMENCIENMVVLKEGIEKTERFNIVSKDQGVPVVAF
SLKDHSFHNEFEISEMLRRFGWIVPAYTMPADAQHITVLRVVIREDFSRTLAERLVSDIS
KVLHELDTLPSKISKKMGIEGIAENVKEKKMEREILMEVIVGWRKFVKERKKMNGVC
Download sequence
Identical sequences R0GGP4
Carubv10020115m|PACid:20906815 XP_006302114.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]