SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10020536m|PACid:20904479 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10020536m|PACid:20904479
Domain Number 1 Region: 191-294
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-32
Family B3 DNA binding domain 0.00000478
Further Details:      
 
Domain Number 2 Region: 68-125
Classification Level Classification E-value
Superfamily DNA-binding domain 7.19e-17
Family GCC-box binding domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10020536m|PACid:20904479
Sequence length 360
Sequence
MDSSCIEEISSSTSESFSTTTAKKLSPPPPPPPPATALRLYRMGSGGSSIVLDPDNGVET
ESRKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEQEEAARSYDIAALRFRGRDAV
VNFKTLLEDGDLAFLEVHSKAEIVDMLRKHTYADELEQNNKRRLFVSLDANGTQRNGSSM
VTNDNVLKTREVLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLPSKSPSSVTKGVLINFED
VNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLRAGDVVTFERSTGLDRQLYIDWKVRS
GPRETPVQVVVRLFGVDIFNVNTVKPNDVVALCGRKRSRDDADDMFGLRCSKKQAIINAL
Download sequence
Identical sequences R0IF20
Carubv10020536m|PACid:20904479 XP_006302450.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]