SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10022415m|PACid:20907031 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10022415m|PACid:20907031
Domain Number 1 Region: 113-253
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-44
Family B3 DNA binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 544-619
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000144
Family PB1 domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10022415m|PACid:20907031
Sequence length 665
Sequence
MAATNPSSEKPGGVLSDALCRELWHACAGPLVTLPREGERVYYFPEGHMEQLEASMHQGL
EQQMPSFNLPSKILCKVINIQRRAEPETDEVYAQITLLPELDQSEPISPDAPVQEPEKCT
VHSFCKTLTASDTSTHGGFSVLRRHADDCLPPLDMSQQPPWQELVATDLHNNEWHFRHIF
RGQPRRHLLTTGWSVFVSSKKLVAGDAFIFLRGENEELRVGVRRHMRQQTNVPSSVISSH
SMHIGVLATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEG
EEAPEKRFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLVANST
PSSQPQPPQRNKRPRPPGLPAPTTGPSAAVTPDSVWKSPADTPSSVPLFSPPAKAAMFGP
GGNKSFGVSIGSAFWPTHADSAAESFASAFNNESTEKKQTNGNVCRLFGFELVENVNVDE
CFSAASVSGAVAVDQPVPSNEFDSGQQSEPLNINQSDIPSGSGDPEKSSLRSPQESQSRQ
IRSCTKVHMQGSAVGRAVDLTRSECYEDLFKKLEEMFDIKGELIESTKKWQVVYTDDEDD
MMMVGDDPWNEFCGMVRKIFIYTPEEVKKLSPKNKLTVNARMQPKNDVEENGNTEGRSSS
MAGSR
Download sequence
Identical sequences R0GC66
Carubv10022415m|PACid:20907031 XP_006300434.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]