SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10022513m|PACid:20903620 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10022513m|PACid:20903620
Domain Number 1 Region: 444-684
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000157
Family Tropomyosin 0.0009
Further Details:      
 
Domain Number 2 Region: 693-908
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000523
Family Tropomyosin 0.0037
Further Details:      
 
Weak hits

Sequence:  Carubv10022513m|PACid:20903620
Domain Number - Region: 978-1070
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0654
Family Myosin rod fragments 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Carubv10022513m|PACid:20903620
Sequence length 1333
Sequence
MEEPTQVASSEVPVVKGDADDLKTVDFSVKAVNGEIPKEEKEEDDGEFIKVEKEAFDSKD
DAKKAEHVPVEEKKEVSVERSSSGSQRELHESQEKAKELELELERVAGELKRYESENTHL
KDELLSAKEKLEEMEKKHGDLEVVQKKQQEKIVEGEERHSSQLKSLEEALQSHDAKDKEL
TEVKEAFDALGIELESSRKKLIELEQGLNRSAEEAQKFEELHKQSASHADSETQKALEFA
ELLESTKESAKEMEEKMASLQQEIKELNNRISENEKVEAALKSSAGELAAVQEELALSKS
RLLETEQKVSSTETLIDELTQELEQKKASESQFKEELSVLQDLDVQIKDLQAKLSEQEGI
NSKLAEELKEKEMLESVLRDQEEKLRTANEKLAEVLKGKEALEANVAEITSNAGKLKEVC
NELEEKLKTSEENFSKTDALLSQALSNNSEHEQKLKSLEELHTEAGSVAAAATQKNLELE
DAVRSSSQAAEEARSQIKELETQFTAAEQKNVELEQQLNLLQLKSSDTERELKELSVKAS
ELKTAIDVVEEEKKQVTSQMQEYQEKASGLESSLNQLSARNSELEEDLRTALQKGAEHED
RANTTHQRSIELEGLCQTSQSKHEDAEGRLKDLELLLQTEKYRIQELEEQVSSLEKKCAE
TEADSKGYVGQVAELQSTLEAFQVKSSSLEAALNIATETEKELTENLNVVMGEKTKLEDT
VNELSTKISESENLLEGLRSELNVTQGKLESIENDLKTSGLRESEVMEKLKSAEESLEQK
GREIDEAMTKNMELEALHQSLSKDSEHRLQKAMEDFTSKDSEASSLTEKLKDLEGRIQSY
EEQLAEASGKSSSLEEELEQTLGRLAAAESVNEKLKQDFDQAQEKSLQSSSENELLAETN
NQLKIKIHELEGLIGSGSVEKETALKRLEEAIEKFNQKETESNDLVEKLKAHENQMEEYK
KLAHEASEVAETRKVELDETLSKLKNLESTIEELGAKCQGLEKESGDLAEVNLKLNQELA
NHGSEANELQTKLSALEAEKEQTAIALQASKTTIEDLTKQLTSEGEKLQSQISSHAEENN
QVNAMFQSTKDELQSVIAKLEEQLTIESSKADTLVSEIEKLRVVAAEKSVLESHFEELQK
TLSEVKAQLKENVENAAAASVKVAELTSKLQEHEHIAGERDVLNEQVLQLQKEIQVTQNS
FAEQKEAHSKKQSELESALKQSQEEIEAKKKASAEFESMVKDLEQKVQLADAKVKETEAR
DVSVKSRDIDLSFSSPTKRQSKKKSDASPSSSSNVTTTTTTQTASTSHLMTVKIITGVAL
VSVIIGIILGKKY
Download sequence
Identical sequences R0HAP6
XP_006293565.1.15642 XP_006293566.1.15642 Carubv10022513m|PACid:20903620 Carubv10022514m|PACid:20903619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]