SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10022672m|PACid:20901898 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10022672m|PACid:20901898
Domain Number 1 Region: 274-369
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-22
Family B3 DNA binding domain 0.0069
Further Details:      
 
Domain Number 2 Region: 113-211
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.92e-22
Family B3 DNA binding domain 0.0077
Further Details:      
 
Domain Number 3 Region: 607-700
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.73e-20
Family B3 DNA binding domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Carubv10022672m|PACid:20901898
Sequence length 787
Sequence
FDCSSSQNSLILDSPINPEGDMMFQVADHQDNNIEFQRNKKVKQNNHETESDYSYALVRL
YYFDFCLVCSDLVYSPTQTKYLPQDLTSSNGLTRKCSKSPRQIFSSYSSSEKQFVTFRLA
PVDGRHCRLRLPMQFTRENGINKPGKIYLLGKDGSKWLANLLSESNRGRMTLGDGWKSFV
KANGLKTGESVTLRLYWEDTTPVLSLCPEVYNTETRVGEECLDASEKESFPIEPSSKVEI
IKDDINKDKNTKDESSSWERENHHMRCMDSTSPSQNHILTLKITPDCLKHGRLRIPLQFM
TENSMNKPGEITLLGKDGAKWLASLLLEKRGRMSLGKGWKEFAKANGLKTDDSITFELIW
ENATPILKLLRIESSYGRRESGFSKESLTMEPNRGNKTKKADNNREESKMYPPRCRESTT
TIQNQFMALTFTCNTISLGAHDPQTREAFIFRHEGDNMLHISDLGHSCFGIRDVTAPSSK
NDHDRIGNISMKMHPHLSQEAGFSSYDGDDHGNFEGPSKKVKKNNPETQEDYSSDHSRFV
TTSSLHANALSLAVKESLPIKPSNVRKISEYDNNKDENSKEENNIEVSSSCEREKNHLRC
IASISPSQNRYVTLTITPDSLRQGRLRLPLEFMTENGMNKPGEITVLGKDGVKWLVSLLL
ERRGRLSLGKGWKDIAKENGLKTGDSITLESIWEDASPMLKLLHIESSSVSCFTDASSGH
KTREAENIREESSSSPKLKKRTYCPRKRDSSSDIQNRFLTLTLTHEDVRDGNLVSLLKHL
FALEVIS
Download sequence
Identical sequences R0FUN0
Carubv10022672m|PACid:20901898 XP_006293714.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]