SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10022794m|PACid:20902104 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10022794m|PACid:20902104
Domain Number 1 Region: 51-261
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.91e-55
Family G proteins 0.00014
Further Details:      
 
Domain Number 2 Region: 201-356
Classification Level Classification E-value
Superfamily Translation proteins 2e-24
Family Elongation factors 0.0089
Further Details:      
 
Domain Number 3 Region: 455-571
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 4.12e-21
Family EF-G/eEF-2 domains III and V 0.017
Further Details:      
 
Domain Number 4 Region: 361-444
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.00000000273
Family EF-G/eEF-2 domains III and V 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10022794m|PACid:20902104
Sequence length 664
Sequence
MAGPLLRSLWSNTTRRSFSSPSKFGYSLSSFRSFSAATASSAAAGAPSSSLDPNRLRNVA
VIAHVDHGKTTLMDRLLRQCGADIPHERAMDSINLERERGITISSKVTSVFWKDNELNMV
DTPGHADFGGEVERVVGMVEGAILVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKVDRP
SVTEERCDEVESLVFDLFANLGATEEQLEFPVLYASAKEGWASSTYTKEPPVDAKNMSQL
LDAVVRHVQPPKANLEEPFLMLVSMMEKDFYLGRILTGRVTSGVVRVGDKVNGLRKTDSG
TEKIEEAKVVKLMKKKGTTIVSIDAAGAGDIICMAGLTAPSIGHTVASAEVTTALPTVEL
DPPTISMTFGVNDSPLAGRDGTHLTGGRIGDRLLAEAETNLAINVIPGLSESYEVQGRGE
LQLGILIENMRREGFELSVSPPKVMYKTEKGQRLEPIEEVTIEINEEHVGLVMEALSHRR
AEVIDMGPVPGNDGRTRLSLTCPSRGLVGYRCVFSSDTRGTGFMHRAFLTYEKYRGPLGN
VRKGVLVSMGFGTITAHSLMSLEARGILFVGPGLDSYDGMIIGEHSRDTDLDVNPVRAKE
LTNIRSAGKDENVKLSPPRLMTLEEAIGYVASDELIEVTPKTIRLRKRCLDVNKRKSLSK
RAKE
Download sequence
Identical sequences R0FUW2
XP_006293809.1.15642 Carubv10022794m|PACid:20902104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]