SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10022841m|PACid:20903373 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10022841m|PACid:20903373
Domain Number 1 Region: 110-254
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.07e-38
Family B3 DNA binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 492-571
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000000438
Family PB1 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10022841m|PACid:20903373
Sequence length 606
Sequence
MANVVDADFGRSGSNDGQLYTELWKACAGPLVEVPRSGERVFYFPQGHMEQLVASSNQGV
VDQEIPVFNLPPKILCRVLSVMLKAEHETDEVYAQITLHPEEDQSEPTSLDPPLVEPAKP
KVDSFVKILTASDTSTHGGFSVLRKHATECLPLLDMTQATPTQELVARDLHGYEWRFKHI
FRGQPRRHLLTTGWSTFVTSKKLVAGDAFVFLRGETGDLRVGVRHLARQQSTMPASVISS
QSMRLGVLATASHAVNTKSIFIVLYKPRISQFIISVNKFMVAMKNGFSFGMRFRMRFEGE
ESPERIFTGTIIGSGDLSSQWPASKWRSLQIQWDESSSIQRPNKVSPWEIEPLSPSALTP
TPTHPQSKSKRSRPIDSSVSEITGSPVASNFLSSFSQSNESNPSGKLLFHDPATERNVDK
TVLSSGLQGKNSEAPGTSCCRLFGFDLTSKPASAPVPPDRQLISVNSNNSDSTTKCQDPN
SSNSTREQKQQTSTRSRTKVQMQGTAVGRAVDLTLLRSYDELIKELEKMFEIEGELNPKD
KWAVVFTDDEDDIMLVGDDPWDEFCKMAKKLFIYSSDEVKKMSSKSLLDDEATIVNLESE
QRTVQD
Download sequence
Identical sequences R0HBF0
XP_006293856.1.15642 Carubv10022841m|PACid:20903373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]