SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10022859m|PACid:20901899 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10022859m|PACid:20901899
Domain Number 1 Region: 243-338
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.67e-22
Family B3 DNA binding domain 0.0069
Further Details:      
 
Domain Number 2 Region: 82-180
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-22
Family B3 DNA binding domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10022859m|PACid:20901899
Sequence length 597
Sequence
MMFQVADHQDNNIEFQRNKKVKQNNHETESDYSCLVTHVTASSQHTDALYLPQDLTSSNG
LTRKCSKSPRQIFSSYSSSEKQFVTFRLAPVDGRHCRLRLPMQFTRENGINKPGKIYLLG
KDGSKWLANLLSESNRGRMTLGDGWKSFVKANGLKTGESVTLRLYWEDTTPVLSLCPEVY
NTETRVGEECLDASEKESFPIEPSSKVEIIKDDINKDKNTKDESSSWERENHHMRCMDST
SPSQNHILTLKITPDCLKHGRLRIPLQFMTENSMNKPGEITLLGKDGAKWLASLLLEKRG
RMSLGKGWKEFAKANGLKTDDSITFELIWENATPILKLLRIESSYGRRESGFSKESLTME
PNRGNKTKKADNNREESKMYPPRCRESTTTIQNQFMALTFTCNTISLGAHDPQTREAFIF
RHEGDNMLHISDLGHSCFGIRDVTAPSSKNDHDRIGNISMKMHPHLSQEAGFSSYDGDDH
GNFEGPSKKVKKNNPETQEDYSSDHSRFVTTSSLHANALSLAVKESLPIKPSNVRKISEY
DNNKDENSKEENNIEVSSSCEREKNHLRCIASISPSQNRYVTLTITPDSLRQGRLVS
Download sequence
Identical sequences R0HRK5
Carubv10022859m|PACid:20901899 XP_006293715.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]