SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10023444m|PACid:20901847 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10023444m|PACid:20901847
Domain Number 1 Region: 278-376
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.49e-22
Family B3 DNA binding domain 0.0061
Further Details:      
 
Domain Number 2 Region: 134-235
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.24e-22
Family B3 DNA binding domain 0.0059
Further Details:      
 
Domain Number 3 Region: 4-100
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.4e-19
Family B3 DNA binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Carubv10023444m|PACid:20901847
Sequence length 378
Sequence
MASKHFFKPLLPGFYSHLTIPIAFLLNIKGRNEQKTVELRSDASKITWKVKIDGERLTDG
WKEFAVAHDLRIGDIVVFRQERDMAFHVTLLGPSCCEIQYVSCLEDHNNLRMIQRKKRVR
KNPRREAESSSLDPSCFVANITPSTLLYDRLHFPRSFARENGLDTRCGEIVLMNEKGRSW
TVDLRGKSSCGSAYIKRGWRSFCHANGLSAGSFFTFRLIQRGRTLVLRLFPKETEEEEVE
VVCLSTEEESDKERSQDDSQECSKRKEKKISKASSSGSQNRFVTLTLTRYNVSLSRLTLP
IPFTKASGIRLAKEMSFLDKHGVKWSTRLRFEKERKRMRLVGGWKEFCNANHVKIGESVL
LELIWEKHKSSVLKFCSK
Download sequence
Identical sequences R0HTE7
XP_006294430.1.15642 Carubv10023444m|PACid:20901847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]