SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10023826m|PACid:20901776 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10023826m|PACid:20901776
Domain Number 1 Region: 13-107
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000275
Family B3 DNA binding domain 0.00095
Further Details:      
 
Domain Number 2 Region: 186-262
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000765
Family B3 DNA binding domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10023826m|PACid:20901776
Sequence length 276
Sequence
MKTQGSNGDLSQKFFRVYIPNVTEDNMNLPFVSNMISGTPLPRKVTVRSVSSGNTWRMEM
TTNRESDTVFLRDGWKKIFKDENLIEPIFLVFEFDGSRVFHFCVYEHSSMCKRMRSHIEQ
EVIEVESDEECEDDDGDDVTVEDEESTKGSDEWPGRKERGGTSRKTDSHDKLDEYLDDEL
NPSFPVDLTQPRLRIPSILIKDYNLTFSNLVIVRDKIGKMKRRISVWKNRSVYLNGLSSV
IRRNHVKPGDKMLCELRMVDGYHGLVHEIKVHIIKG
Download sequence
Identical sequences R0FY44
XP_006294773.1.15642 Carubv10023826m|PACid:20901776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]