SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10023925m|PACid:20903913 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10023925m|PACid:20903913
Domain Number 1 Region: 35-143
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.24e-31
Family B3 DNA binding domain 0.0000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10023925m|PACid:20903913
Sequence length 248
Sequence
MSITQYSSDFHYHSLMWQQQQHHHHHQNDVVEEKEALFEKPLTPSDVGKLNRLVIPKQHA
ERYFPLAAAAADAVEKGLLLCFEDEEGKPWRFRYSYWNSSQSYVLTKGWSRYVKEKHLDA
GDVVLFHRHRADGGRFFIGWRRRGDSSSSSDSYRHHQSNASLQYHPHAGAQAVESPRANS
KTLRLFGVNMECQLDSEWSEPSTPDGSNTCTTNHDQFHFYPHQQHYPPPYYMDISFTGDV
NRTRSPQG
Download sequence
Identical sequences R0HR36
Carubv10023925m|PACid:20903913 XP_006294872.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]