SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10024004m|PACid:20901058 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10024004m|PACid:20901058
Domain Number 1 Region: 108-212
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000255
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10024004m|PACid:20901058
Sequence length 226
Sequence
MVFKQKEKDAEVVIAARILMHISQAQAPEEDDTDDEVEFEDESTPLLQVSQRADTNQPKK
VENQNMMRIDKKERFSEEKQRLIQTWYRAEPEPPEIFDEVPRPFNKPLKKQLKLSDVDGN
QSRLMLPRQFVAESIVPFLEASENPSVGINVLVYRPDRKVQHMIFKLWKRAPFLTSGWKE
FVTKYSLMKTSDFVTVWVFRHLKTRKLCFAIDHIRFPLMENQVGSS
Download sequence
Identical sequences R0FYK2
XP_006294948.1.15642 Carubv10024004m|PACid:20901058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]