SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10024885m|PACid:20901612 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10024885m|PACid:20901612
Domain Number 1 Region: 169-293
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000141
Family B3 DNA binding domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10024885m|PACid:20901612
Sequence length 300
Sequence
MLSVRKHYCLCLNSKPTLREYRRLQLSIRKDAEKRDSLRRNKSSTTITTRSSTVVEYYSM
LEDEDLEDHNLAPPMERESKKTKQSKKDAMKRTSLPYISSAITTRITTIMESLLKEEDLK
EYNLPPCMEKQTKKETGNKKDATLKIRETTPEWLRMLMREKKDGDEEDDSKKIIVKELTE
TDVNDNNNRLSIPITDVVELDFLRPAEELILEEDLKRFRNKIGVNSILLVVSFDRKEIKE
YKMSLKLWPMTGRFLYNLITRWKQVVRDCRLRREHKVSLWSFHSKDQLCFVLVPFPAKYD
Download sequence
Identical sequences R0FZV2
Carubv10024885m|PACid:20901612 XP_006295764.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]