SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10024937m|PACid:20902477 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10024937m|PACid:20902477
Domain Number 1 Region: 166-273
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000981
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10024937m|PACid:20902477
Sequence length 308
Sequence
RIEKKMDNSDDARVVSHSKLEMLLYVAAMVYDQEYGTHAEDRSKTIGEVETEVEARIFGG
SVPRKSRSRRSSSSRKMVTTPWTRVIERQRSELQNPNAESEPSSSSCVTQIKKRRHDQID
VEERSRKKLKKTVRGLEVEPIQTSPPEWLLNVMRREENGYNPKLISTRKLYQTDLDKLQA
RLSVPFRQVKNHDFLTEQETIVIHENAMKTREEGVSVDLVDPEMKKHALELRKWKMVGNW
NYVLCKGWKNVVSANRFEVNDVFPLWSFRSGRGKLCFALVPPPTASDGASTSGESSHGCS
SFDDSPHL
Download sequence
Identical sequences R0HGA0
XP_006295811.1.15642 Carubv10024937m|PACid:20902477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]