SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10025209m|PACid:20904258 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10025209m|PACid:20904258
Domain Number 1 Region: 2238-2528
Classification Level Classification E-value
Superfamily BEACH domain 1.7e-123
Family BEACH domain 0.00000001
Further Details:      
 
Domain Number 2 Region: 2650-2720,2758-2872,2899-2946
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.79e-32
Family WD40-repeat 0.0065
Further Details:      
 
Domain Number 3 Region: 2118-2227
Classification Level Classification E-value
Superfamily PH domain-like 5.59e-25
Family PreBEACH PH-like domain 0.0019
Further Details:      
 
Domain Number 4 Region: 464-607
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000368
Family Clostridium neurotoxins, the second last domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10025209m|PACid:20904258
Sequence length 2965
Sequence
MEEDDERKLPEADVTDKPDIANPLQSRIEAFDIGDSSFIAKDDTALQGISSADRVFKDDD
FEQVSLGDQEKAVNESQGDLMEPGSTSNSDIGRSSFGATEGLTYHLSGTQEMYDLMPIDD
VQSDRLSSAGPEKETPDSLQQSLSEPSPDSLHHLESGYSPVHSPQKPKPKATVPNVSPEL
LHLVDSAIMGKPESLDKLKNVVSGIENFGAGEESEATAFLVIDSLIATMGGVESFEEDED
SNPPSVMLNSRAAIVSGELIPWLPGLGDSVNFMSPRTRMVRGLLVILRSCTRNRAMCSTA
GLLGVLLRSVEEIISKDVDMKWNAAAVLLLCIQHLAGHSLSVDDLHRWLQLIKTAIATAW
SSPLMLALEKTMTGKESRGPACTFEFDGESSGLLGPGESRWPFTNGYAFATWIYIESFAD
TLNAATAAAAIAAAAAAKSGKTSAMSAAAAASALAGEGTAHMPRLFSFLSADNQGIEAYF
HAQFLVVESGSGKGRKSSLHFTHAFKPQCWYFIGLEHSCKQGLLGKTESQLRLYIDGSLY
ESRPFDFPRISKPLSFCCIGTNPPPTMAGLQRRRRQCPLFAEMGPVYIFKEPIGPEKMAR
LASRGGDVLPCFGNGAGLPWLATNDYVRNRAEENSNLDADIGGYAHLLYHPCLLSGRFCP
DASLSGAAGTLRRPAEVLGQVHVATRIKPVESFWALAYGGPMSLLPLTVSNVHKDSLEPC
PGNLPLSLSTVTLAAPVFRIMAVAIQHPGNNEELCRTQGPEILARILSYLLHSLASLDRK
HDGVGEEELVAAIVSLCQSQKINHVLKVQLFRTLLLDLKIWSLCNYGLQKKLLSSLQDMV
FTEATAMRNAEAIQLLLDGCRRCYWMISEKDSETTFPLDGNTRQMGELNALIDELLVIIE
LLMGAASPSLASDDLRRLLGFIIDSPQPNQVARVLHLMYRLVVQPNAARAQMFAEVFITS
GGIETLLVLLQREAKTGEDNVLDMGKSGVRSSTDQSEKSQNDGSTSVKKLDSSVESSGPD
GNSVEDDNLGSLTEPASDPQEKEHVFSSVIRENDSNSISHSIDTERISSVSEIGGISLSI
SADSARNNVYNVDNSDAVVVGVIRLIGALISSGHLTFDSVARSDATSNIVGSGLHENGGT
MFDDKVALLLFALLKAFQSAPNRLMTDNVYTTLLGASINASSTEDGLNFYDSGHRFEHSQ
LLLVLLRSLPSAPKALQSRALQDLLFLACSHPENRSSLTKMEEWPEWILEILISNYEKDA
GKQSVLAGSSEVEDLIHNFLIIMLEHSMRQKDGWKDIEATIHCAEWLSIVGGSSTGEQRI
RREESLPIFKRRLFGGLLDFAARELQAQTQVIAAAAAGVAAEGLTPKDAKAGAENAAQLS
VFLVENAIVILMLVEDHLRLQSKQICTTNAVDASPSPLSLVSLKNRTSTLTAIGESSEIS
SSRASLSSDSGKVPLDILASMADSSGQISAVAMERLTVAAAAEPYESVSCAFVSYGSCAM
DLAEGWKYRSRLWYGVGFPSKTSSFGGGGSGSDSWKSTLEKDTHGNWIELPLVKKSVSML
QALLLDESGLGGGLGIGGGSGTGMGGMTALYQLLDSDQPFLCMLRMVLLSMREEDYGEDN
MLMRNLSSELSSGNSVTLDSGSQMSMRQSRSALLWSVLSPILNMPISDSKRQRVLVTACV
LYSEVWHAISLDRRPLRKQYIEAILPPFVAVLRRWRPLLAGIHELATADGMNPLVVDDRA
LAADALPVEGALSMITPEWAAAFASPPAAMALAMIAAGAAGWEAPPPPTPSHFRRDSSML
ERKTAKLQTFSSFQKPLEPPNNNAPPRPRDKAAAKAAALAAARDLERNAKIGSGRGLSAV
AMATSAQRRNIGDLERLQRWNTSEAMGVAWMECLQPMDTKSVYGKDFNALSYKFIAVLVA
SFALARNMQRSEIDRRMQDDIIAANRLCLGSRGWRKLIRYLAEMRCFFGPFGDEICSPER
VFWKLDSMESFSRMRQCIRRDYCGTDHLGAAANYDDQTDTKSDNGSKGSPSNPPILAADA
ISMEIAYEDDEHGEGDHLDIKGNAEEYRRENEERISGSHEHASRNSAGTSDPRTSNDREM
VRDSSAVSPGFVPSELDERILLEFPTSMVRPLRVVKGTFQITTRRINFIVDIRESQNLTD
HSYGSQSRDQEKDRTWPMSSLHQIYSRRYLLRRSALELFMVDRSNFFFDFGNTDGRRNAY
RAIVQARPPHLNNIYLATQRPEQLLRRTQLMERWARWEISNFEYLMQLNTLAGRSYNDIT
QYPVFPWIISDNSSESLDFSNPSTFRDLSKPIGALNPERLKKFQERYSSFEDPVIPKFHY
GSHYSSAGAVLYYLARVEPFTTLSIQLQGGKFDHADRMFSDIPGTWNGVLEDMSDVKELV
PELFYLPEVLTNENSIDFGTTQLGEKLDAVKLPPWAKNPVDFVHKQRRALESEHVSAHIH
EWIDLIFGYKQRGKEAIMANNVFFYITYEGTVDIDKITDPVQQRATQDQIAYFGQTPSQL
LTVPHMKRMPLKDVLHMQTIFRNPKEIKPYAVQAPERCNIPASAIQASSDSVVIVDMNVP
AARVAQHKWQPNTPDGQGTPFLFHHGKATSTSTSGSFVRMFKGPASSGTGDWQFPQAQAF
VASGIRSSSVVAITSDGEIITGGHADNSIKLVSSDGAKTLETAFGHCAPVTCLALSPDNN
FLVTGSRDSTVLLWRIHKAFTSRTSVSEPSTGSGAASSASNTNLANTSANKGKNCRLEGP
IQVLRGHRREVICCCVSSDQGVVVSSSESSDVLLHSTRKGRLIRRLVGVTADSLCISSDG
VIMAWSSLEGSVSVFTINGVLIAKAKLPFSCSISCMEISMDGQNALIGMNSCSRMDLSST
NDTSTDGKEIERLDVPSPSICFLNLYTLKVFHVLKLGQGQDITALALNVDDTNLIVSTED
KQLIIFTDPALSLKVVDQMLKLGWE
Download sequence
Identical sequences R0HY27
Carubv10025209m|PACid:20904258 XP_006296060.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]