SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10025316m|PACid:20903979 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10025316m|PACid:20903979
Domain Number 1 Region: 164-277
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000141
Family B3 DNA binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Carubv10025316m|PACid:20903979
Sequence length 285
Sequence
KYLEKNVKAKVANIIIYIIIIYIILVQSQIESNIIRKLSTSVLIHTSGGENRKRMMQNQQ
QDLLQSSAVKMPPPSAASHTQYLLYRKSSENPNKTLVSTTLCLSSCENPRKRNLDDPAKV
SCTPSDDKLTKEERNIKRMRNLSNEEKEKEERFGVSTELALFKDPWIITKVLTTSDLGQL
SRLLLHTAPIEEHIIKYLNKEDQINVQEGLGITVEVYDHDTHSTYELLLKRWTTMHSYVL
NGGWRMYFVRRRGLGKGDEVGLFWDRFASRLHFRVLSRAARSQEP
Download sequence
Identical sequences R0G1F9
XP_006296163.1.15642 Carubv10025316m|PACid:20903979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]