SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10025498m|PACid:20901406 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10025498m|PACid:20901406
Domain Number 1 Region: 125-214
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.57e-19
Family B3 DNA binding domain 0.0042
Further Details:      
 
Domain Number 2 Region: 3-99
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.24e-18
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 3 Region: 251-334
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000129
Family B3 DNA binding domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10025498m|PACid:20901406
Sequence length 337
Sequence
MANQHFFKPLLPGFHSFLTIPVAFFLKNIGGRNEQMAAELRSDVSKITWKVKIDGQRLTS
GWKEFALAHDLRIGDILVFKLERDMSFHVTMLGPSCCQYVPSLHNQNNLGKIQSKKKEAT
SSVDLSCFVAKVTTSNLRFDSLNLPLSFVRANGLDKRCGEIILINEKGRSWTVDLKQKTS
CEATYIKRGWRSFCQANGLRAGSFFTFKLIQRGRSLGLLRLSPREIKEEDGLSEANVVKS
TLIWKPSLSPSQNRFVTVTLTPYNLRESNLAKKMSLLDKHGVKWSTKMSFEVKRQRMRLK
GGWKEFCNANGVKIGESVILELVWEADRSSVLKFCSK
Download sequence
Identical sequences R0HUY2
Carubv10025498m|PACid:20901406 XP_006296327.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]