SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10025683m|PACid:20904275 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10025683m|PACid:20904275
Domain Number 1 Region: 177-290
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000275
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10025683m|PACid:20904275
Sequence length 351
Sequence
MMKSDDRSVYKQIFCELIKQTIPENPQTFGCLEVEPSSRPSSDVDKEYSTDGDDKIITLL
CAASMPLEHEAKVDKSEKEEPRVYSGWINMVEMMHEVIGERLESLLELVRNPNQDSESSS
VRGRSKNKRPIDVEERSRKKRKVVRALEVEPIQMIPPEWLLNVMRREENGYNPKLISTRK
LYQTDLDILQARLSVPFRQVKTPDFLTEQETMIIHENAMKTREEGVSVDLVDPEMKKHAL
ELRKWKMSGNWNYVLCKGWKDVVSANRFEVNDVFPLWSFRSGKGKLCFALVPSQPNNSSY
GSGNSLTGGDGASSSGESGQVPLPVNPPLPPARDSSHSSQGFSGESSSSSP
Download sequence
Identical sequences R0HVE6
XP_006296497.1.15642 Carubv10025683m|PACid:20904275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]