SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10025688m|PACid:20903671 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10025688m|PACid:20903671
Domain Number 1 Region: 20-122
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.1e-17
Family B3 DNA binding domain 0.0045
Further Details:      
 
Domain Number 2 Region: 449-544
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000647
Family B3 DNA binding domain 0.014
Further Details:      
 
Domain Number 3 Region: 137-220
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000844
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Carubv10025688m|PACid:20903671
Sequence length 549
Sequence
LGRRKKVRTNKSEFKAGSSSSDDNNSFFVLVTDANLKADSLNLPKDYTYSSVLNKTCHKI
VLTDGSNNSWELDLKFNQFSGCFYITRGWRHFCDENGKKAGNVFTFELTNRGETPLLTFS
PSNSTLSYETSEGLDKFVTYIPADFLGKHGLDIETRMVTLLRKDGTRMLATLSREYSTSN
LGRMSLTRGWRQFVKASHLKEGEHITFECIWQNATPILKLTETKSNIPIKRSRKKYTRAS
KKVSTVSTKPNVGKEPEKDKNMEEPIITALLPPTEDSRVVTEPLMNDEKEPEKDKNMEEP
ISALLPPTENNRVVTEPNRNDGKEPKKDKNMEEPISPLLPPTENNRVVTEPNRNDGKESE
KDKNMEEPRSPLKPPTENNRVVTESNRNDGKELEKDNNMEEPRSPLQPPTENNRVVTEPN
RDDGKELEKDQNIEEPTSPLISSLIQNRRVVVLPLVPADVKASTLWLPRKFMKDNGINKI
GKIVMWGRNEVESWCGFLLSKDGMVAVGCGWENFCETNGVKIGESFSLEFIMRRADATPV
LQFKPKSRS
Download sequence
Identical sequences R0HI61
XP_006296501.1.15642 Carubv10025688m|PACid:20903671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]