SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10025860m|PACid:20911685 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10025860m|PACid:20911685
Domain Number 1 Region: 161-293
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.27e-40
Family B3 DNA binding domain 0.0041
Further Details:      
 
Domain Number 2 Region: 750-826
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000128
Family PB1 domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10025860m|PACid:20911685
Sequence length 875
Sequence
MASSEVSMKGNRGGDNFSSSGYTDPKETRNVSVAGDGQISHSNRSVAAERAVDPEAALYR
ELWHACAGPLVTVPRQDDRVFYFPQGHIEQVEASTNQAAEQQMPLYDLPSKLLCRVINVD
LKAEADTDEVYAQITLLPEANQDENAIEKEAPPPPPPRFQVHSFCKTLTASDTSTHGGFS
VLRRHADECLPPLDMSRQPPTQELVAKDLHANEWRFRHIFRGQPRRHLLQSGWSVFVSSK
RLVAGDAFIFLRGENGELRVGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAISTGTMF
TVYYKPRTSPSEFIVPFDQYMESVKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGTEESDP
TRWPKSKWRSLKVRWDETSSIPRPDRVSPWKIEPALAPPALSPVPMPRPKRPRSNIAPSS
PDSSMLTKDGTAKANMDPLPASGLSRVLQGQEYSTLRTKHIENVECDAPENSVVWQSSTD
DDKVDVVSASKRYGSENWMSSARHEPTYTDLLSGFGNNIDPPHGQRIPFYDHSSSPSMPA
KKILSDPEGKFDYLANQWQMMHSGLSLKLHESPKAPAASDSSFQGLGNGKYSEYPVLNGL
STENGGGNWPIRPRALNYFEEVVQAQAQAQAQAQAQAQAQAQAQAQARDQVTKQPMTIQE
EGAKSRDGNCRLFGIPLINNMNGTDSSMSQRNNLNDAVGFTQVASAKVQDLSDQSKGSKT
TNDHREQGRPLPTSNPHPKDAQTKTNSSRSCTKVHKQGIALGRSVDLSKFQNYEELIAEL
DRLFEFNGELMAPKKDWLIVYTDDENDMMLVGDDPWQEFCCMVRKIFIYTKEEVRKMNPG
TLSCRSEEEVVVGEGSDAKDAKSASNPSLSSAGNS
Download sequence
Identical sequences R0EUS7
XP_006279989.1.15642 Carubv10025860m|PACid:20911685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]