SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10025912m|PACid:20911347 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10025912m|PACid:20911347
Domain Number 1 Region: 164-283
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.03e-42
Family B3 DNA binding domain 0.004
Further Details:      
 
Domain Number 2 Region: 664-744
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000231
Family PB1 domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Carubv10025912m|PACid:20911347
Sequence length 790
Sequence
MEFDLNTEIAEVEEEENDDVGVRIDKARLGISPSSSSSCSSGSSSSSSSTGSASSIYSEL
WHACAGPLTSLPIKGNVVVYFPQGHLEQDAMVSFPSPLEIPKFDLNPQIFCRVVNVQLLA
NKETDEVYTQVTLLPLQEFSMLNPEGKEVRELGGDEERNGSSTVKRTPHMFCKTLTASDT
STHGGFSVPRRAAEDCFAPLDYKQQRPSQELIAKDLHGVEWKFRHIYRGQPRRHLLTTGW
SIFVSQKNLVSGDAVLFLRDEDGELRLGIRRAARPRNGLPDSVIEKNSCSNILSPVANAV
STKSMFHVFYSPRATHAEFVIPYEKYVTTIRNPVCIGTRFRMRFEMDDSPERRCAGVVTG
VCDLDPYRWPNSKWRCFLVRWDESFVSDHQERVSPWEIDPSVSLPHLSIQSSPRPKRPWA
GVLDTTPPRKPITERGGFLDFEESVRPSKVLQGQENIGSASPSQGFDVLNRRILDFAMQS
HANPVLLSSRVKDRFGEFVDATAIDPACSGVMDLDRFPRVLQGQEICSLKSFPQFAGFTP
AATSGKPTLGYTDPFARQANKSSFYPLALHGIRSTHVPYQNPYNAGNQSSGRPSRAINFG
EETRKSDALNESGLPNNVTADLPFKIDMMGKQKGGEFNMNVSSGCKLFGFSLPVETPTPN
PQGSSKRICTKVHKQGSQVGRAIDLSRLNGYDDLLTELERLFNMEGLLRDPEKGWRILYT
DSENDMMVVGDDPWHDFCNVVWKIHLYTKEEVENANDDNKSCLEQAALMMEASKSSSVSQ
PDSSPTVTRV
Download sequence
Identical sequences R0G8Q0
Carubv10025912m|PACid:20911347 XP_006280031.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]