SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10026146m|PACid:20914031 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10026146m|PACid:20914031
Domain Number 1 Region: 42-183
Classification Level Classification E-value
Superfamily POZ domain 2.75e-16
Family BTB/POZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 268-361
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000133
Family Ankyrin repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10026146m|PACid:20914031
Sequence length 579
Sequence
MATLTEPSSSLSFTSSHFSYGSIGSNHFPSSSASNPEVVSLSKLSSNLEQLLSNPDCDYS
DAEIIVDGVPVGVHRCILAARSKFFQELFKKEKKNSKTEKPKYQLKEMLPYGAVGHEAFL
YFLSYIYTGRLKPFPLEVSTCVDPVCAHDSCRPAIDFVVQLMYASSVLQVPELVSSFQRR
LCNFVEKTLVENVLPILMVAFNCKLNDLLDQCIERVARSDLYRFCIEKELPSEVAEKIKQ
IRLKSPQDGGESKVSEKLLERIRKILKALDSDDVELVKLLLNESDITLDEANGLHYSVVY
SDPKVVAEILNLGMGDVNFRNSRGYTVLHFAAMRREPSIIISLIEKGANASELTSDGRGA
VNILRRLTNPKDYHTKAAKGRESSKARLCIDILERQIRKNPMVLDSPMCSLSMPEDLQMR
LLYLEKRVGLAQLFFPTEAKVAMDIGNVEGTSEFTGLPPPLNGLTGNLSQVDLNETPQML
TKRLLTRMEALMKTVETGRRFFPYGSEVLDKYMDEYIDDDILDDLRIEKGSSQERRLKRM
RYRELKDDVQKAYSKDKESKIARSCLSASSSPSSSIKDV
Download sequence
Identical sequences R0EVF8
Carubv10026146m|PACid:20914031 XP_006280229.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]