SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10026947m|PACid:20912886 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10026947m|PACid:20912886
Domain Number 1 Region: 125-223
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.89e-23
Family B3 DNA binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10026947m|PACid:20912886
Sequence length 273
Sequence
MAYEEARKLRLQENLKRFQDLGISQISKALLTQIPKKTLQRNPRPIDKALFATAEPRRSS
RVRTPISSYRDDVDVDTGPTLNLRRSRRNSSWDSYIARPKHECKFASYEEKVGALKAAEE
FQSRLESPHPSFVKSMLRSHVYSCFWLGLPSGFCVDNFSEETIEVVLEDEEGEEYEAVYI
GKRTGLSGGWKRFALDHKLDDGDALLFELVEPKRFKIYVFRGNESANLTSKEKRVRARQS
EEEDKDVEESGDEGDSSRATKRLSSRLLRKRKA
Download sequence
Identical sequences R0GRK8
Carubv10026947m|PACid:20912886 XP_006280945.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]