SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10027909m|PACid:20912869 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10027909m|PACid:20912869
Domain Number 1 Region: 12-111
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-19
Family B3 DNA binding domain 0.00034
Further Details:      
 
Domain Number 2 Region: 215-319
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000412
Family B3 DNA binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Carubv10027909m|PACid:20912869
Sequence length 320
Sequence
MWFSICEGKYLEDCLPKFFKVYLPDDSGDDLEIPISFTRFLPEPFPETVTVRSISGSLWT
LQFRKCSGEVERFVLVDGWKMIVKDEDLKGGDFLGFEFDGSQLFNFCIYERETMCKRLRH
CSEQSEELIVESDIEEGTQDSDDDDVSALDDDSEDSDYNYVEDYDSDAALEEEDNDGDET
DIYVVNDAATEENDVDVEAFKLGDHASEDDRNHLDDPENPSFTLRLNPKKKSQLLIPARV
INDYGLHFPESITLVDPLVKKFGTLEKLIKIQTNGSVFVKGFGSIIRRNKVKTTDKMICE
MEKTGDNNMVQTMKIHIIRG
Download sequence
Identical sequences R0GU01
Carubv10027909m|PACid:20912869 XP_006281750.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]