SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10028109m|PACid:20912281 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10028109m|PACid:20912281
Domain Number 1 Region: 9-106
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.9e-19
Family B3 DNA binding domain 0.00084
Further Details:      
 
Domain Number 2 Region: 217-305
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000608
Family B3 DNA binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Carubv10028109m|PACid:20912281
Sequence length 371
Sequence
MVETGKDLEFFKVFLPEFSSHELVIPPAFIDLLVGKPLPKEAFLLDEIGRLWRVEIKTED
TEERFCVSFQKGWECFAKDQSLEFGDFLVFSYDGGSRFSVTIFAKDGTKKDVGVVATTER
SRVSLEKDPVHIFTKPERRKDCKRKREHDSVLDKPEYVSTSKTKPGHREKIQRTTVNRAG
VKWFNLNHVFVRCCYNVDPCDISWSSDSEDGFEESVYKPKNPHFLRNITCSSFHKLEIPI
TFLRSNGIELEEEIELCDEDGKKWPLKVENHVRGLRFSCETWSCFSKGHKLMKNHKFLLE
FVASSGRCKEIQVRVVKEVICVYSPEKSTKRDGFRIIKVYLSSFIFYTHQPSIFVFEEYR
SSLKKEAITCR
Download sequence
Identical sequences R0GUD3
XP_006281905.1.15642 Carubv10028109m|PACid:20912281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]