SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10028125m|PACid:20912287 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10028125m|PACid:20912287
Domain Number 1 Region: 178-499,528-548
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.2e-19
Family Cystathionine synthase-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10028125m|PACid:20912287
Sequence length 580
Sequence
MHQTKKMQQPCSGDHSPPPNCLHGCFSSSPFHGATTTTSEHPSDSTPTVTSATLRRNFAQ
TTVSTIFPDTQFADPNSLPSHQESFSDFIQAYPNYSDTYKIDRIRSDHYFHLGLSHYTCL
DYIGIGLYSYSQLLNYDPSTYQISSSLSESPFFSVSPKIGNLKEKLLNDGGQETEFEYSM
KRRIMSFLKISEEDYSMVFTANRTSAFRLVAESYPFNSKRKLLTVYDYESEAVNEINRVS
EKRGAKVAAAEFSWPRLKICSSKLRKLVTTGKTGSKKKKKKGIFVFPLHSRVTGSRYPYL
WMSVAQENGWHVMIDACGLGPKDMDSFGLSIYNPDFMVCSFYKVFGENPSGFGCLFVKKT
TIPILESSTGSGMVNLVPTDNPISLHALEINRIQTESEETYSFSSSVEYKGLDHVDSLGL
VATGNRSRCLINWLVSALHKLKHSTTSRLVKIYGPKVDFNRGPAVAFNLFNQKGEKIEPF
IVQKLAGCSNISLGKGFLKNIMFEEDYEGAKDRVFEKRRNRDVNEPGISVLTAALGFLAN
FEDVYKLWIFVARFLDSEFVDNESGRCGVHVFEHESREVV
Download sequence
Identical sequences R0EV61
XP_006279823.1.15642 Carubv10028125m|PACid:20912287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]