SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10028409m|PACid:20912293 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10028409m|PACid:20912293
Domain Number 1 Region: 1-79
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000192
Family B3 DNA binding domain 0.00086
Further Details:      
 
Domain Number 2 Region: 163-257
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000116
Family B3 DNA binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Carubv10028409m|PACid:20912293
Sequence length 262
Sequence
VLPISFNCCLPNPLPKTVTIRSTYGKIWNMVLRKCGGEVERFVLVNGWKKIVKDEDLNGG
DLLAFEFDGSRCFNFSIYEHETMCKRVKRSSEQNLESDGEEETRTSNDVIVLHDDDTDDS
DSDYHHASVEDDDDAEDEDVEPEPEDDAENEHDDDVEDEDKDDHRNPQFTVTLNPNRKSQ
LHIPAHVIRDFDLTFPERITVVDKLGALEKEIKIQVNGCIFVKGFGSVFRRNKVKTTDQM
ICEVKRTGANVVHTIKVNVIRG
Download sequence
Identical sequences R0GRU6
Carubv10028409m|PACid:20912293 XP_006282152.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]