SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10028515m|PACid:20912784 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10028515m|PACid:20912784
Domain Number 1 Region: 3-106
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.04e-17
Family B3 DNA binding domain 0.00035
Further Details:      
 
Domain Number 2 Region: 258-352
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000124
Family B3 DNA binding domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10028515m|PACid:20912784
Sequence length 353
Sequence
NSVDDRLPKFFKVYLPDESGDDLELPISFNTFLPSSLPKNVIVRSICGNIWKMAFRKCCG
DIERLVMVHGWKKIVKNVGLKGGEFLEFEFDGSRCFNFCIFGHETCKKLRSSEQIKEIEH
VSDGEDDKCSDDDITVLNDGVIDDQYYGDEDRSSENIIVLDEEISDVQDCNEEDTYSEDT
TVLDYADNDDTNDVQDYGEEDTSGEDIIVIEDDDDDQDYGDDNYAEEEDERRRGLQTERK
EKSSSGEHDRQYLDNHMNPFFTVNKKNMQRENLRIPTKVIANNGLHFSEFINLIDPLEQK
FGKLKRRIEGQRIRRFGSIIRRNNVKLTDKVICELEKEMDGLVREFKVHVIRG
Download sequence
Identical sequences R0GS24
XP_006282242.1.15642 Carubv10028515m|PACid:20912784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]