SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46447112|ref|YP_008477.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46447112|ref|YP_008477.1|
Domain Number 1 Region: 477-573
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000412
Family Anti-sigma factor antagonist SpoIIaa 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|46447112|ref|YP_008477.1|
Sequence length 640
Comment sulfate transport protein [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MSHSHHDEVSLIAFQKDFEKYSWSAFRLDLLSGLSVSMLTVPQVMAYALVAGLPVSCGIL
ASVFSAIVVAIFCSSRHLIVGPSNAIAILIQACISEILFTYYRDISGPEKEQLILQILSQ
LMLLVGAIQILAAFFKLGRLTHFVSHTVIIGYISGVALALVINQIFPLLGMPVPRHLSSL
YEMSVYILTHLTTINWPTALIGVTCLSLLLILRRIDRKLPSGAIVLAIVALVAYFFGYIY
NYFIVNEYQFFNWEYIGKIMEPIALVGETNGEGLIPNWGLPYFNTGIMNNLLPVAFAIAL
LSVMEATTASKSIAVKSGQHLSTNQEIFGVGLGNFFGAFIGAMPVSGSAARSSLNFENGA
KTRLAAIVSSLTVALILFAFGFLIRHIPVAAFAALLVASASNIVNLKQLFVCLKATRSDA
FVLILTILSCIFFRLDIAFYIGVIMSISLYLKKAAIPQLVEFTVDNEGVLHTIDHHHLQE
PRSIRFIKVEGELFFGSADLFQAALKSITEDDTTTRVLILQLKNARDIDATTCLALQQLH
HYLKSSGRHLIGCGLTHQIWDVLSDSGIIDIVGKSNLFIFDEKHPQLSVQKAFIRAHELL
SIDTANISEIVPPITAMPMPEAISDSQVIDPSSVISPVAN
Download sequence
Identical sequences Q6MB47
gi|46447112|ref|YP_008477.1| WP_011176025.1.90613 264201.pc1478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]