SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|33863465|ref|NP_895025.1| from Prochlorococcus marinus str. MIT 9313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33863465|ref|NP_895025.1|
Domain Number 1 Region: 17-142
Classification Level Classification E-value
Superfamily YjgF-like 5.65e-44
Family YjgF/L-PSP 0.0000596
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|33863465|ref|NP_895025.1|
Sequence length 142
Comment hypothetical protein PMT1195 [Prochlorococcus marinus str. MIT 9313]
Sequence
MMQHSCSEQTMNAPSVQAITTASAPAPVGPYNQAVLAGGWLYCSGQIALDPTNGVMVGQG
DVEAETRQVLSNLMAVLTAAGAEPRQVIRTTVYLTDLADFQRVNALYGEIFGDGISPARA
CVQVAALPKGGRVEIDCVAWLG
Download sequence
Identical sequences Q7V6G7
gi|33863465|ref|NP_895025.1| 74547.PMT1195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]