SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|33863633|ref|NP_895193.1| from Prochlorococcus marinus str. MIT 9313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33863633|ref|NP_895193.1|
Domain Number 1 Region: 11-127
Classification Level Classification E-value
Superfamily YjgF-like 5.49e-44
Family Chorismate mutase 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|33863633|ref|NP_895193.1|
Sequence length 128
Comment chorismate mutase [Prochlorococcus marinus str. MIT 9313]
Sequence
MTTAIPYGSLHLHGLRGATTSSANTTKAIEAAVSELVKALMQRNQLNPADIVSITFSVTA
DLNACFPAAIARQQAGWESIALLDCQQMYVEGDLKRCIRMLAHAWLPSDQPPQHPYLGET
SLLRPDRC
Download sequence
Identical sequences Q7V615
gi|33863633|ref|NP_895193.1| 74547.PMT1366 WP_011130734.1.51355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]