SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|48477447|ref|YP_023153.1| from Picrophilus torridus DSM 9790

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|48477447|ref|YP_023153.1|
Domain Number 1 Region: 2-87
Classification Level Classification E-value
Superfamily IHF-like DNA-binding proteins 1.62e-20
Family Prokaryotic DNA-bending protein 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|48477447|ref|YP_023153.1|
Sequence length 90
Comment DNA-binding protein [Picrophilus torridus DSM 9790]
Sequence
MVGISELSKTVAKKTDTTQKKARDVIREFLAEVVSQADSGQKINLAGFGIFERKTQSPRT
ARNPQTRAEIKVPAKKKFVFRASSKIKYKQ
Download sequence
Identical sequences A0A1W2G2Z9 Q6L242
gi|48477447|ref|YP_023153.1| 263820.PTO0375 WP_011177176.1.10384 WP_011177176.1.75556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]