SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGTT_02913 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_02913
Domain Number 1 Region: 2-231
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 1.96e-69
Family ArgJ-like 0.000042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGTT_02913
Sequence length 234
Comment | PGTG_02913 | Puccinia graminis f. sp. tritici arginine biosynthesis argJ (235 aa)
Sequence
MGPPHATLLGLIATDAAVRPDTLQRALTKAVDRSFNRISVDGDMSTNDTILILANGAAGN
KPLDHADPADQKRLEIFEHELASFALRLAKLVVRDGEGATKFVQVLVRGAQNEADATTIA
TTIATSSLVKCALNGEDANWGRILCALGYSPISHPIDTQKVSVSIRTADDLQQILLLSNG
EPVPDIDELKAKEILKNEDLIIDLDLGHPIDHQASFYTCDLSKEYVAINADYRS
Download sequence
Identical sequences PGTT_02913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]