SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGTT_07362 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_07362
Domain Number 1 Region: 42-151
Classification Level Classification E-value
Superfamily TPR-like 2.32e-27
Family Tetratricopeptide repeat (TPR) 0.0016
Further Details:      
 
Weak hits

Sequence:  PGTT_07362
Domain Number - Region: 301-364
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0418
Family MgtE N-terminal domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGTT_07362
Sequence length 406
Comment | PGTG_07362 | Puccinia graminis f. sp. tritici predicted protein (407 aa)
Sequence
MEAGNNKRPTAQVFKDKASCISYTRITSRSVFLDEKLTFVDLNPQGNEAFKKADFQAAVE
HYTAAIKADPSDHILPCNRAFARLKLQQWKLAEADCTKSLELLPEPNCKALFRRGTARRQ
LNKWNDALADLKAALALEPNNASICAELEAVKSHLQVCTLTIANERCNNSRNIIATKRIN
AKFDRPSSSTALTDKRSSDSSNSLMKEVSTTRFTSSDPKNSTTKAAAGTSFSALKQIRQK
KEEKSSGLLTCRNPKTSASSPTDLSKCEAKPTKIPSSSSTNSIPPVRSFADFEMRWGMSS
QPELRCSVLEALDQRHVARLFGEHLEPETLEQIIDAMQVLLKANEKAKIKKAVELLQEMD
NVSRMGTLTMFLGSDHQKGMSLNYLAIINSLTRRVAHTCFVNHLLQ
Download sequence
Identical sequences PGTT_07362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]