SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGTT_04813 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_04813
Domain Number 1 Region: 87-366,427-459,487-527
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.55e-79
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000116
Further Details:      
 
Domain Number 2 Region: 30-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000031
Family Ubiquitin-related 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGTT_04813
Sequence length 531
Comment | PGTG_04813 | Puccinia graminis f. sp. tritici ubiquitin carboxyl-terminal hydrolase 14 (532 aa)
Sequence
MARRSTTSNSTHPNHPAHSNKPFTNSPESILVKGGQLKDESDWSKLAIKPGHQFMLIGTA
GELPPPPTQQAIFVEDLTETELAEADPFPAGLENLGNTCYLNSTVQVLRAIPELQTNLTK
YTRAADPSRNDVALTCSLRDTYQDLTKSSDGYSPFNLIATLRSYAPQFAQQTQGHYAQQD
AEECWVQLLSAVRSTLDSSVGTDGKFVERYLTGELETETKCTEAPEEPPTISKEKWLELK
CNISISTNYMITGIQDGLKQPLEKLSPSLGRSAQYLQTSKISRLPAYLAIHMVRFYWRRD
INKKTKIMRKVKFPFNLDLTDLLSDKLKSQVGPAASKLKDIEKDRRERIKIQKKKKIAKE
ESSKNQMAIDQQPNGAGAASTSSAPPPTEEKPIEGAQEEEEEDEATIREREAAVLMSLMD
PELVNDVGTNPTAQYELCGIVTHKGASADGGHYMAWVRCDAAKANPNLPQPSTSEPSSST
KKLEHQDPDDQEWYKFDDEKVSIVHKDKILGLDGGGEDSIAYILLYRPTKI
Download sequence
Identical sequences PGTT_04813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]