SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGTT_15364 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_15364
Domain Number 1 Region: 219-397
Classification Level Classification E-value
Superfamily HAD-like 3.44e-20
Family NLI interacting factor-like phosphatase 0.059
Further Details:      
 
Domain Number 2 Region: 83-167
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000278
Family Ubiquitin-related 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGTT_15364
Sequence length 442
Comment | PGTG_15364 | Puccinia graminis f. sp. tritici predicted protein (443 aa)
Sequence
MTTNQGNKPSITVEHHLPIHEEQTEPSKRPKLDTQPQGPSTNNVPSSSSSSSSPSSENQA
NNRTMEHGKNQECNSREVSDGEDSPSEALELTFSWRDSTFNVALDGMVTIKDLKVVIYSV
TAVPPERQKILGLVLGQIPADDVLLSTLQFKIKKGVHFKLLGTPEDEGLSTAPPETSSSS
TLDQSDSHSIRKARQSQDCVLYMTRVREKLDELSSHLELNIMNPPRPGKKLLVLDLDYTL
MDSKAYSDYSVHALDLHEFLTALWPYYDICIWSATSWRWLESKLVELGMVGGNYSDKYQI
QFVLDRGTMFEVTSMRHGKISRHEVKALELIWRKIPAYNETNTVHLDDLSRNFALNPRSG
VKLSAFKNARVNKHDRQLVFLARYFLQIASLSDVRTVDHKKWADCRLPLPVGSSDPLEIL
DPADPELVKFKTSHHLPPPPPS
Download sequence
Identical sequences PGTT_15364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]