SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGTT_16532 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_16532
Domain Number 1 Region: 220-406
Classification Level Classification E-value
Superfamily HAD-like 0.00000000000000569
Family NLI interacting factor-like phosphatase 0.051
Further Details:      
 
Domain Number 2 Region: 84-169
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000243
Family Ubiquitin-related 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGTT_16532
Sequence length 451
Comment | PGTG_16532 | Puccinia graminis f. sp. tritici predicted protein (452 aa)
Sequence
MTTNQGNKPSITVEHHLPIHEEQTEPSKRPKLDTQPQGPSTNNVPSSSSSSSSSSPSETQ
ANNRTMENGKNQECNSREVSDGEDSPSEALELTFSWRDSTFNVALDGMVTIKDLKVVIYS
VTAVPPERQKILGLVLGQIPADDVLLSTLQFKIKKGVHFKLLGTPEDEGLSTAPPQTSSS
STLDQSDSHSIRKARQSQDCVLYMTRVREKLDELSSHLELNIMNPPRPGKKLLVLDLDNQ
PKIKGIYTLMDSKAYSDYSVHALDLHEFLTALWPYYDICIWSATSWRWLESKLVELGMVG
GNYSDKYQIQFVLDRGTMFEVTSMRHGKISRHEVKALELIWRKIPAYNETNTVHLDDLSR
NFALNPRSGVKLSAFKNARVNKHDRQLVFLARYFLQIASLSDVRTVDHKKWADCRLPLPV
GSSDPLEILDPADPELVKFKSSHHLPPPPPS
Download sequence
Identical sequences PGTT_16532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]