SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.002G002600.1|PACid:26795052 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.002G002600.1|PACid:26795052
Domain Number 1 Region: 77-152
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.96e-29
Family Skp1 dimerisation domain-like 0.0000546
Further Details:      
 
Domain Number 2 Region: 8-69
Classification Level Classification E-value
Superfamily POZ domain 1.62e-20
Family BTB/POZ domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.002G002600.1|PACid:26795052
Sequence length 154
Sequence
MASSTSKKVTLRSSDGVIFVVDEAVALKSQTIKNMIEDDCADGEIPTPGVTGNTLAKVLE
FCTKHVDDKDDELPTKFKDWDANFAKVDQNTLFYLTLAANFLNIKSLLGLMCQTVADMIK
GKSPEEIRKTFNIENDFTPEEEEEIRRENAWAFN
Download sequence
Identical sequences A0A0D2QY17
Gorai.002G002600.1|PACid:26795052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]