SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.002G146100.2|PACid:26795554 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Gorai.002G146100.2|PACid:26795554
Domain Number - Region: 695-731
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000471
Family Rho termination factor, N-terminal domain 0.03
Further Details:      
 
Domain Number - Region: 26-73
Classification Level Classification E-value
Superfamily TerB-like 0.0693
Family COG3793-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.002G146100.2|PACid:26795554
Sequence length 737
Sequence
MAFELWGTSFTEEENSSFIQTEWQYDLYFGYGIDMIEENALNEKSCIQVLRILIAKADTE
IDELEKDLVLLQSELVWAEHEEWHDICCNALRAKINCLDISIRKLRNKDENDIEVYLLMH
TEPVEKLHEIMKSLLKSFCNEKHEQNEQSQDVVPDSRSSSLEQSAALYKNQKLNSSDSCF
IAKEENNGPNVTPKENFTSSNRSMELEVKKANSSETLANADVKDLMPHFLLPAAGQFDEK
SIITLLDLETTKKLKESGCALKDKNVVRHFSLKSAQKRKNNPYRTKVKDAAAQCVNDSDL
DASKHSAGRLKKKKKTSSSSLKILSEQATKHTSISAADMLILDSSSNSMGMTGDLTKKVK
TADIIANDLGLIAHKQMTGDSNEMKTLGKHDVRINGCEVQGQDTSNFSNSCLNPEHEGNI
QKADKVENLKFDMDQKLCDFGVKSARKQRIKESKVASMDKNQHSNSLLKGEEKRNDTLQD
VTLKEASPSDNEHSALTSLVELQDENGEDKTIQLMEEKSQMEEVPMSEVVSSDGKLVTNS
YMRLQRGKVKTVKPNMESTAADAEESGLNSMENLSNSSPFPKGKRTWKNANNCSLNYSLT
GKIIKKTVQHSQCEAEETSLMLDASQNTMPLPQKKCKKLSSVPIVVEFRASSVQMNISKL
HGDLNKSNIVKTEFAESGALVDDLGAKGVVPRPLDANSLMKMKLRDLRAIAKSQKLKKYS
TMKKEDLVKRLENGLSC
Download sequence
Identical sequences A0A0D2Q6F0
Gorai.002G146100.2|PACid:26795554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]