SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.002G146100.4|PACid:26795555 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Gorai.002G146100.4|PACid:26795555
Domain Number - Region: 693-729
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000471
Family Rho termination factor, N-terminal domain 0.03
Further Details:      
 
Domain Number - Region: 26-73
Classification Level Classification E-value
Superfamily TerB-like 0.0693
Family COG3793-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.002G146100.4|PACid:26795555
Sequence length 735
Sequence
MAFELWGTSFTEEENSSFIQTEWQYDLYFGYGIDMIEENALNEKSCIQVLRILIAKADTE
IDELEKDLVLLQSELVWAEHEEWHDICCNALRAKINCLDISIRKLRNKDENDIEVYLLMH
TEPVEKLHEIMKSLLKSFCNEKHEQDVVPDSRSSSLEQSAALYKNQKLNSSDSCFIAKEE
NNGPNVTPKENFTSSNRSMELEVKKANSSETLANADVKDLMPHFLLPAAGQFDEKSIITL
LDLETTKKLKESGCALKDKNVVRHFSLKSAQKRKNNPYRTKVKDAAAQCVNDSDLDASKH
SAGRLKKKKKTSSSSLKILSEQATKHTSISAADMLILDSSSNSMGMTGDLTKKVKEEQTA
DIIANDLGLIAHKQMTGDSNEMKTLGKHDVRINGCEVQGQDTSNFSNSCLNPEHEGNIQK
ADKVENLKFDMDQKLCDFGVKSARKQRIKESKVASMDKNQHSNSLLKGEEKRNDTLQDVT
LKEASPSDNEHSALTSLVELQDENGEDKTIQLMEEKSQMEEVPMSEVVSSDGKLVTNSYM
RLQRGKVKTVKPNMESTAADAEESGLNSMENLSNSSPFPKGKRTWKNANNCSLNYSLTGK
IIKKTVQHSQCEAEETSLMLDASQNTMPLPQKKCKKLSSVPIVVEFRASSVQMNISKLHG
DLNKSNIVKTEFAESGALVDDLGAKGVVPRPLDANSLMKMKLRDLRAIAKSQKLKKYSTM
KKEDLVKRLENGLSC
Download sequence
Identical sequences A0A0D2NN65
XP_012466841.1.20347 Gorai.002G146100.4|PACid:26795555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]