SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.003G007300.2|PACid:26801038 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.003G007300.2|PACid:26801038
Domain Number 1 Region: 79-146
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.22e-24
Family Skp1 dimerisation domain-like 0.0000479
Further Details:      
 
Domain Number 2 Region: 6-67
Classification Level Classification E-value
Superfamily POZ domain 1.77e-22
Family BTB/POZ domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.003G007300.2|PACid:26801038
Sequence length 148
Sequence
MSSSGRKITLKSSDGESFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEY
CKKHVEAPKTDDRSADDELKSWDADFVKVDQATLFDLILGLLDLTCQTVADMIKGKTPEE
IRKTFNIKNDFTPEEEEEVRRENQWAFE
Download sequence
Identical sequences A0A0D2QDY6
Gorai.003G007300.2|PACid:26801038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]