SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.003G124000.1|PACid:26799626 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.003G124000.1|PACid:26799626
Domain Number 1 Region: 22-91
Classification Level Classification E-value
Superfamily TSP9-like 4.32e-22
Family TSP9-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.003G124000.1|PACid:26799626
Sequence length 91
Sequence
MASLLIPFVPSTTRVFAAKSSAAGGTKQEKGFLDWILGNLQKEDQFYETDPLLKKVEDKN
GSARTSNGRRESVSVPQKKKGSVFGGLFAKK
Download sequence
Identical sequences A0A0D2MMZ2
XP_012471200.1.20347 Gorai.003G124000.1|PACid:26799626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]