SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.004G158900.9|PACid:26775349 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.004G158900.9|PACid:26775349
Domain Number 1 Region: 2-62
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.00000000000017
Family Skp1 dimerisation domain-like 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.004G158900.9|PACid:26775349
Sequence length 250
Sequence
MDTKRLCELTSAADSLQLKPLVDLTSRALARIIEGKAPEEIREIFHLPDDLTEEEKLEPL
KNATDDPRIRLLNRLYAKKRKELKEREKLKNVEVDEELVDDRSVDDLLSFINGDDGDSKG
IKTSKSKKKNRRRKDLLKSTSAHEATKNHNKESNGLNSVCRSAEVGQILPGVGATTNLQD
VEDDIFPNKNEFDDGDIDDEIDPTLKEKIDREVEDFARRLNSDWPERMQEILSLGQEKKP
VHLSLNGKGS
Download sequence
Identical sequences A0A0D2S0E3
Gorai.004G158900.1|PACid:26775350 Gorai.004G158900.9|PACid:26775349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]