SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.004G221100.1|PACid:26776440 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Gorai.004G221100.1|PACid:26776440
Domain Number - Region: 368-401
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000133
Family Rho termination factor, N-terminal domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.004G221100.1|PACid:26776440
Sequence length 407
Sequence
FIKQKNRKPCEKECKTATTLCFEASLMSHALHLVPNNIPGYGPTDCRYLSYSGISGRAVT
LSPCSSHSDHKICTQVNVRSLKCSSRGIISFVCRAGPGGRRRNPDFSRQRPGYRGKNRQN
EDRENFENLDESEMISSKNGPLLSLSGSTKFQATAAPGPREKEIVELFRKVQAKLRERTA
AKEDTKIEASQGKGKESETVDSLLKLLRKHSVEQGKKKNSNVSSRDLNLDTPEVNGSSNE
DKSFSFFGSNDRVRSETKESYAPSLSRPASNFRKKSPVPQMKYQTLYSDEEMVNSVTHVN
SDRKRNLSLAKSHPAVNDVPELEEELESESDPELESESIYQESDMLDELSEDESSDVDEE
DREQHIEHEDLSALKLPELRALAKSRGLKGFSKMKKSDLVAILSSLS
Download sequence
Identical sequences A0A0D2R8W8
Gorai.004G221100.1|PACid:26776440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]