SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.004G269000.1|PACid:26776698 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.004G269000.1|PACid:26776698
Domain Number 1 Region: 87-160
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 9.94e-19
Family Skp1 dimerisation domain-like 0.0003
Further Details:      
 
Domain Number 2 Region: 7-68
Classification Level Classification E-value
Superfamily POZ domain 6.67e-16
Family BTB/POZ domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.004G269000.1|PACid:26776698
Sequence length 169
Sequence
MSTTVPKKITLRTADNHEFEVDEAVAMELGTVKTFFDENPDATDEPIPLPNVSSKCLSTI
IEYCKFHLSLRARGNDSSSAEEEGKVYDEELIKAHDNESLVELILAVNYLNIKDMLDTLN
QGVADRIKNKSVEYVRRFFGIENDYTPEEEAEIRAQYEWAFEGVDPDDD
Download sequence
Identical sequences A0A0D2S6S7 A0A1U8LKS0
XP_012477013.1.20347 XP_016715120.1.88148 Gorai.004G269000.1|PACid:26776698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]