SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.008G036500.1|PACid:26817754 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.008G036500.1|PACid:26817754
Domain Number 1 Region: 77-139
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.27e-24
Family Skp1 dimerisation domain-like 0.00011
Further Details:      
 
Domain Number 2 Region: 6-66
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000597
Family BTB/POZ domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.008G036500.1|PACid:26817754
Sequence length 141
Sequence
MGSTSKKIKLRTSDGEILKVEEAVALQSPTIKNLYENSCPGRVIPVPGVTGNILSKVLDY
GKKHVDAATGKENISADELKAWDDDFVKVDQKTLFDLILAARSLNIECLLDLTCRTVANM
IKGKTVEEIRTTFNIKNDLDP
Download sequence
Identical sequences A0A0D2PNC8
Gorai.008G036500.1|PACid:26817754 XP_012436384.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]